PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04043A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 133aa    MW: 14626.5 Da    PI: 10.2599
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04043AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.1e-1362106347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +W++eE+ l++ + ++lG g+W+ I+r + ++Rt+ q+ s+ qk+
  Oropetium_20150105_04043A  62 PWSEEEHRLFLVGLEKLGRGDWRGISRGFVTTRTPTQVASHAQKF 106
                                8******************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.38355111IPR017930Myb domain
SuperFamilySSF466892.32E-1757112IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1758110IPR006447Myb domain, plants
SMARTSM007179.0E-1059109IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-1059102IPR009057Homeodomain-like
PfamPF002491.2E-1062105IPR001005SANT/Myb domain
CDDcd001674.89E-1062107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 133 aa     Download sequence    Send to blast
MEDCLTLQGS ASPPIYYALG APLFLSSMDK GGEMRANTEG GLSDDGGPGG PAAFRERKKG  60
VPWSEEEHRL FLVGLEKLGR GDWRGISRGF VTTRTPTQVA SHAQKFFLRQ NSAGKKNGKR  120
RERKNYSYYQ LV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1846734e-68KF184673.1 Saccharum hybrid cultivar R570 clone BAC 008G08 complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961036.23e-49PREDICTED: transcription factor MYB1R1-like
SwissprotQ8S9H79e-29DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3Z7V46e-49K3Z7V4_SETIT; Uncharacterized protein
STRINGSi022624m2e-48(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP49323066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-31MYB_related family protein